Last updated on 2018-07-29 17:48:35 CEST.
| Flavor | Version | Tinstall | Tcheck | Ttotal | Status | Flags | 
|---|---|---|---|---|---|---|
| r-devel-linux-x86_64-debian-clang | 1.3 | 1.91 | 26.89 | 28.80 | ERROR | |
| r-devel-linux-x86_64-debian-gcc | 1.3 | 1.41 | 21.55 | 22.96 | ERROR | |
| r-devel-linux-x86_64-fedora-clang | 1.3 | 33.42 | ERROR | |||
| r-devel-linux-x86_64-fedora-gcc | 1.3 | 32.72 | ERROR | |||
| r-devel-windows-ix86+x86_64 | 1.3 | 6.00 | 51.00 | 57.00 | ERROR | |
| r-patched-linux-x86_64 | 1.3 | 1.68 | 24.54 | 26.22 | ERROR | |
| r-patched-solaris-x86 | 1.3 | 50.70 | ERROR | |||
| r-release-linux-x86_64 | 1.3 | 1.87 | 24.36 | 26.23 | ERROR | |
| r-release-windows-ix86+x86_64 | 1.3 | 6.00 | 52.00 | 58.00 | ERROR | |
| r-release-osx-x86_64 | 1.3 | OK | ||||
| r-oldrel-windows-ix86+x86_64 | 1.3 | 4.00 | 49.00 | 53.00 | ERROR | |
| r-oldrel-osx-x86_64 | 1.3 | OK | 
Version: 1.3
Check: examples
Result: ERROR
    Running examples in ‘SequenceAnalysis-Ex.R’ failed
    The error most likely occurred in:
    
    > base::assign(".ptime", proc.time(), pos = "CheckExEnv")
    > ### Name: SequenceAnalysis.AAC
    > ### Title: SequenceAnalysis.AAC
    > ### Aliases: SequenceAnalysis.AAC
    > 
    > ### ** Examples
    > 
    > SequenceAnalysis.AAC("AKMNAAKMQWYVIGLPCERTDRSCTRQWYVPIG")
          A       R       N       D       C       E       Q       G       H       I 
    0.09091 0.09091 0.03030 0.03030 0.06061 0.03030 0.06061 0.06061 0.00000 0.06061 
          L       K       M       F       P       S       T       W       Y       V 
    0.03030 0.06061 0.06061 0.00000 0.06061 0.03030 0.06061 0.06061 0.06061 0.06061 
          U       X 
    0.00000 0.00000 
    > SequenceAnalysis.AAC("O15131",Sequence=FALSE)
    Error in if (Protein_Sequence == "N/A") stop("Protein Sequence is not available") : 
      argument is of length zero
    Calls: SequenceAnalysis.AAC
    Execution halted
Flavors: r-devel-linux-x86_64-debian-clang, r-devel-linux-x86_64-debian-gcc, r-patched-linux-x86_64, r-release-linux-x86_64
Version: 1.3
Check: examples
Result: ERROR
    Running examples in ‘SequenceAnalysis-Ex.R’ failed
    The error most likely occurred in:
    
    > ### Name: SequenceAnalysis.AAC
    > ### Title: SequenceAnalysis.AAC
    > ### Aliases: SequenceAnalysis.AAC
    > 
    > ### ** Examples
    > 
    > SequenceAnalysis.AAC("AKMNAAKMQWYVIGLPCERTDRSCTRQWYVPIG")
          A       R       N       D       C       E       Q       G       H       I 
    0.09091 0.09091 0.03030 0.03030 0.06061 0.03030 0.06061 0.06061 0.00000 0.06061 
          L       K       M       F       P       S       T       W       Y       V 
    0.03030 0.06061 0.06061 0.00000 0.06061 0.03030 0.06061 0.06061 0.06061 0.06061 
          U       X 
    0.00000 0.00000 
    > SequenceAnalysis.AAC("O15131",Sequence=FALSE)
    Error in if (Protein_Sequence == "N/A") stop("Protein Sequence is not available") : 
      argument is of length zero
    Calls: SequenceAnalysis.AAC
    Execution halted
Flavors: r-devel-linux-x86_64-fedora-clang, r-devel-linux-x86_64-fedora-gcc, r-devel-windows-ix86+x86_64, r-patched-solaris-x86, r-release-windows-ix86+x86_64, r-oldrel-windows-ix86+x86_64