CRAN Package Check Results for Package SequenceAnalysis

Last updated on 2018-07-29 17:48:35 CEST.

Flavor Version Tinstall Tcheck Ttotal Status Flags
r-devel-linux-x86_64-debian-clang 1.3 1.91 26.89 28.80 ERROR
r-devel-linux-x86_64-debian-gcc 1.3 1.41 21.55 22.96 ERROR
r-devel-linux-x86_64-fedora-clang 1.3 33.42 ERROR
r-devel-linux-x86_64-fedora-gcc 1.3 32.72 ERROR
r-devel-windows-ix86+x86_64 1.3 6.00 51.00 57.00 ERROR
r-patched-linux-x86_64 1.3 1.68 24.54 26.22 ERROR
r-patched-solaris-x86 1.3 50.70 ERROR
r-release-linux-x86_64 1.3 1.87 24.36 26.23 ERROR
r-release-windows-ix86+x86_64 1.3 6.00 52.00 58.00 ERROR
r-release-osx-x86_64 1.3 OK
r-oldrel-windows-ix86+x86_64 1.3 4.00 49.00 53.00 ERROR
r-oldrel-osx-x86_64 1.3 OK

Check Details

Version: 1.3
Check: examples
Result: ERROR
    Running examples in ‘SequenceAnalysis-Ex.R’ failed
    The error most likely occurred in:
    
    > base::assign(".ptime", proc.time(), pos = "CheckExEnv")
    > ### Name: SequenceAnalysis.AAC
    > ### Title: SequenceAnalysis.AAC
    > ### Aliases: SequenceAnalysis.AAC
    >
    > ### ** Examples
    >
    > SequenceAnalysis.AAC("AKMNAAKMQWYVIGLPCERTDRSCTRQWYVPIG")
     A R N D C E Q G H I
    0.09091 0.09091 0.03030 0.03030 0.06061 0.03030 0.06061 0.06061 0.00000 0.06061
     L K M F P S T W Y V
    0.03030 0.06061 0.06061 0.00000 0.06061 0.03030 0.06061 0.06061 0.06061 0.06061
     U X
    0.00000 0.00000
    > SequenceAnalysis.AAC("O15131",Sequence=FALSE)
    Error in if (Protein_Sequence == "N/A") stop("Protein Sequence is not available") :
     argument is of length zero
    Calls: SequenceAnalysis.AAC
    Execution halted
Flavors: r-devel-linux-x86_64-debian-clang, r-devel-linux-x86_64-debian-gcc, r-patched-linux-x86_64, r-release-linux-x86_64

Version: 1.3
Check: examples
Result: ERROR
    Running examples in ‘SequenceAnalysis-Ex.R’ failed
    The error most likely occurred in:
    
    > ### Name: SequenceAnalysis.AAC
    > ### Title: SequenceAnalysis.AAC
    > ### Aliases: SequenceAnalysis.AAC
    >
    > ### ** Examples
    >
    > SequenceAnalysis.AAC("AKMNAAKMQWYVIGLPCERTDRSCTRQWYVPIG")
     A R N D C E Q G H I
    0.09091 0.09091 0.03030 0.03030 0.06061 0.03030 0.06061 0.06061 0.00000 0.06061
     L K M F P S T W Y V
    0.03030 0.06061 0.06061 0.00000 0.06061 0.03030 0.06061 0.06061 0.06061 0.06061
     U X
    0.00000 0.00000
    > SequenceAnalysis.AAC("O15131",Sequence=FALSE)
    Error in if (Protein_Sequence == "N/A") stop("Protein Sequence is not available") :
     argument is of length zero
    Calls: SequenceAnalysis.AAC
    Execution halted
Flavors: r-devel-linux-x86_64-fedora-clang, r-devel-linux-x86_64-fedora-gcc, r-devel-windows-ix86+x86_64, r-patched-solaris-x86, r-release-windows-ix86+x86_64, r-oldrel-windows-ix86+x86_64